PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.006G145800.1
Common NamePHAVU_006G145800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family TALE
Protein Properties Length: 376aa    MW: 42000 Da    PI: 6.8217
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.006G145800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.5e-093013371955
                         HHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
            Homeobox  19 FeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                          +k +yps++++  LA+++gL+++q+ +WF N+R ++
  Phvul.006G145800.1 301 HYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 337
                         45679*****************************885 PP

2ELK41.13.8e-14257278122
                 ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                         ELK qLlrKYsgyLgsLkqEF+
  Phvul.006G145800.1 257 ELKGQLLRKYSGYLGSLKQEFM 278
                         9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012554.7E-19120164IPR005540KNOX1
PfamPF037903.8E-22121160IPR005540KNOX1
SMARTSM012566.6E-26171222IPR005541KNOX2
PfamPF037911.2E-20175221IPR005541KNOX2
PROSITE profilePS5121311.174257277IPR005539ELK domain
SMARTSM011882.8E-8257278IPR005539ELK domain
PfamPF037896.3E-11257278IPR005539ELK domain
PROSITE profilePS5007113.086277340IPR001356Homeobox domain
SMARTSM003891.2E-12279344IPR001356Homeobox domain
SuperFamilySSF466892.05E-19279354IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.9E-28282342IPR009057Homeodomain-like
CDDcd000861.25E-12289341No hitNo description
PfamPF059206.8E-17297336IPR008422Homeobox KN domain
PROSITE patternPS000270315338IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MCKKAMEGSS NSNGTSYLLA FGENSGGLCP MTMMPLVTSH HAGHHPINPN PSNNTNNNAN  60
TNCLFIPNCS NSGTPSIMLD NNHNNNDDNN NTGVGYYFRE SGHHNHRNNN NGSSSSSSSS  120
AVKAKIMAHP HYHRLLAAYV NCQKVGAPPE VVARLEESCA SAVTMVGDAA GSSCLGEDPA  180
LDQFMEAYCE MLTKYEQELS KPLKEAMLFL QRIECQFKNL TISSSDFGCN EGGDRNGSSE  240
EDVDVQSMID PQAEDRELKG QLLRKYSGYL GSLKQEFMKK RKKGKLPKEA RQQLLEWWSR  300
HYKWPYPSES QKLALAESTG LDQKQINNWF INQRKRHWKP SEDMQFVVMD PTHPHYYVDT  360
VLANPFPMDL SHPML*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1272281LKQEFMKKRK
2278282KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankSOYHOMEOGE0.0L13663.1 Glycine max homeobox-containing (Sbh1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007147684.10.0hypothetical protein PHAVU_006G145800g
SwissprotP466080.0HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLV7BRP00.0V7BRP0_PHAVU; Uncharacterized protein
STRINGGLYMA15G11850.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-133KNOX/ELK homeobox transcription factor